DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXB8

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:217 Identity:67/217 - (30%)
Similarity:100/217 - (46%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TQFPVGQYWGPNY-----------RPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEP- 338
            :::..|:...|||           ||......::..::.:.::      .::...|.|:.|..| 
Human    11 SKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQ------IQEFYHGPSSLSTAPY 69

  Fly   339 -------PTYSSPGGLRGY-PSENYSSSG---------------ASGGLSVGAVG-PCTPNP-GL 378
                   ..:..||...|| |.:..|..|               |:.||...|.| ..:|:| .|
Human    70 QQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQL 134

  Fly   379 HEW---TGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 440
            ..|   ......|:.|:.||::||||||||||||.|:::::|.|::..|.|||||||||||||||
Human   135 FPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRM 199

  Fly   441 KNKKNSQRQANQQNNNNNSSSN 462
            |.||        :||.:...|:
Human   200 KWKK--------ENNKDKFPSS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 2/4 (50%)
Homeobox 150..203 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.