Sequence 1: | NP_001303472.1 | Gene: | Abd-B / 47763 | FlyBaseID: | FBgn0000015 | Length: | 493 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004493.3 | Gene: | HOXB7 / 3217 | HGNCID: | 5118 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 66/204 - (32%) |
---|---|---|---|
Similarity: | 94/204 - (46%) | Gaps: | 39/204 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 272 YYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTT---------------SAAAAAAYMNEAERHVS 321
Fly 322 AAARQSVEGTSTSSY--EPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVG---------PCTPN 375
Fly 376 PGLHEWTGQVSVRKK--RKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR 438
Fly 439 RMKNKKNSQ 447 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Abd-B | NP_001303472.1 | Homeobox | 390..443 | CDD:278475 | 33/54 (61%) |
HOXB7 | NP_004493.3 | Antp-type hexapeptide | 126..131 | 1/4 (25%) | |
Homeobox | 141..193 | CDD:278475 | 32/51 (63%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..217 | 1/4 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3844 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |