DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXB7

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens


Alignment Length:204 Identity:66/204 - (32%)
Similarity:94/204 - (46%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 YYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTT---------------SAAAAAAYMNEAERHVS 321
            ||.......||...:.|..|.:      |:||:               |.|:.||.|........
Human     5 YYANTLFSKYPASSSVFATGAF------PEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGG 63

  Fly   322 AAARQSVEGTSTSSY--EPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVG---------PCTPN 375
            ..|.||..|...:.|  ||.:::    :...|.|. :.||...|.|..|.|         ....|
Human    64 GMAGQSAAGVYAAGYGLEPSSFN----MHCAPFEQ-NLSGVCPGDSAKAAGAKEQRDSDLAAESN 123

  Fly   376 PGLHEWTGQVSVRKK--RKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR 438
            ..::.|.......:|  |:.|:::|||||||||.:|.|:::::|.|:|..|.|||||:|||||||
Human   124 FRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNR 188

  Fly   439 RMKNKKNSQ 447
            |||.||.::
Human   189 RMKWKKENK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 33/54 (61%)
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 1/4 (25%)
Homeobox 141..193 CDD:278475 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.