DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXB5

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens


Alignment Length:246 Identity:69/246 - (28%)
Similarity:105/246 - (42%) Gaps:83/246 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 HTAHWAYNDEGF----------NQHYGS-GYYDRKHMFAYPYPETQFPVGQYWGPNYR------- 299
            ||..:.||..|.          :.|:|: |...|    |:|.|..:        |.:|       
Human    41 HTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSR----AFPAPAQE--------PRFRQAASSCS 93

  Fly   300 ------------------------PDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPT 340
                                    .||.|||:::|   |..|...::|:.:..|..|       .
Human    94 LSSPESLPCTNGDSHGAKPSASSPSDQATSASSSA---NFTEIDEASASSEPEEAAS-------Q 148

  Fly   341 YSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSV---------RKKRKPYSK 396
            .|||...|..|....:|:.|..|          ..|.:..|..::.:         ::.|..|::
Human   149 LSSPSLARAQPEPMATSTAAPEG----------QTPQIFPWMRKLHISHDMTGPDGKRARTAYTR 203

  Fly   397 FQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQ 447
            :|||||||||.||.|:::::|.|:|..|.|:|||:||||||||||.||:::
Human   204 YQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 26/125 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 23/123 (19%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 198..251 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.