DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXA13

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_000513.2 Gene:HOXA13 / 3209 HGNCID:5102 Length:388 Species:Homo sapiens


Alignment Length:333 Identity:83/333 - (24%)
Similarity:125/333 - (37%) Gaps:93/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SVASGASSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAG 239
            :.|:.|::|..:......|.:|||.....:.......||:.::...   .:...|.....:...|
Human    77 AAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAAAA---AAAAAAAAAAASSSGG 138

  Fly   240 PGFE-----------TDTSAAVKRHT--AHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVG 291
            ||..           :..|||.:..:  |...|.      ::|||||....|             
Human   139 PGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYG------YFGSGYYPCARM------------- 184

  Fly   292 QYWGPNYRPD------QTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSS--------------- 335
               ||:  |:      |..|||||||:   |::::..|...:.|.:|.:.               
Human   185 ---GPH--PNAIKSCAQPASAAAAAAF---ADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYH 241

  Fly   336 -YEP----------PTYSSPGGLR----GYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQV 385
             ::|          |....||..|    |.|.|:|.......|.:.....|.......|.|...:
Human   242 HHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL 306

  Fly   386 --------------SVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQ 436
                          ..||||.||:|.|..|||:|:..|.:::|.||..::....|:||||.||||
Human   307 PDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQ 371

  Fly   437 NRRMKNKK 444
            |||:|.||
Human   372 NRRVKEKK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
HOXA13NP_000513.2 HoxA13_N 85..222 CDD:403486 36/166 (22%)
Homeobox 325..379 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.