DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXA11

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_005514.1 Gene:HOXA11 / 3207 HGNCID:5101 Length:313 Species:Homo sapiens


Alignment Length:329 Identity:96/329 - (29%)
Similarity:139/329 - (42%) Gaps:93/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 HLTSPHHQQLPQ--QQTPNS--VASGASSNLQQQQQQQNA-----AVAPG--------------- 198
            :::.|....||.  .|||:|  :....||||.|.|..:..     |:.|.               
Human    21 YVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSA 85

  Fly   199 -----QTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWA 258
                 :..:.||:.|.| |..|.: |...|:      .|.|.    |...::..:.|.|:    .
Human    86 EELVHRDCLQAPSAAGV-PGDVLA-KSSANV------YHHPT----PAVSSNFYSTVGRN----G 134

  Fly   259 YNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAE------ 317
            ...:.|:|.:.:.|...:::.:..||..:   ....||   |..|.::|||||....|.      
Human   135 VLPQAFDQFFETAYGTPENLASSDYPGDK---SAEKGP---PAATATSAAAAAAATGAPATSSSD 193

  Fly   318 -------RHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPN 375
                   |..:|||.:     ......|.:.|||          .||||.:...:.|:.|..|  
Human   194 SGGGGGCRETAAAAEE-----KERRRRPESSSSP----------ESSSGHTEDKAGGSSGQRT-- 241

  Fly   376 PGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRM 440
                        ||||.||:|:|..|||:||.|:.|::|:||.:|:|.|.||:||||||||||||
Human   242 ------------RKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRM 294

  Fly   441 KNKK 444
            |.||
Human   295 KEKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 34/52 (65%)
HOXA11NP_005514.1 DUF3528 25..167 CDD:314855 33/160 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..246 30/126 (24%)
Homeobox 244..297 CDD:306543 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.