DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXA10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_061824.3 Gene:HOXA10 / 3206 HGNCID:5100 Length:410 Species:Homo sapiens


Alignment Length:341 Identity:102/341 - (29%)
Similarity:145/341 - (42%) Gaps:82/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QTPTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQ---QQNAAVAPGQTQIVAPTT 207
            :.|.||....||....|..   |.|..|.:.:...:.|::::..   ..:|...|.    |:.|.
Human   128 EPPDGPPPPPQQQPPPPPQ---PPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK----VSATA 185

  Fly   208 ASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGP---GFETDTSAAVK---RHTAHWAYNDEGFNQ 266
            |.::|                       ...||   |....||:.|.   ......||   |..:
Human   186 AELAP-----------------------FPRGPPPDGCALGTSSGVPVPGYFRLSQAY---GTAK 224

  Fly   267 HYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGT 331
            .||||....:.:.|.|:|..  |.|:  |.:..|...:.:|.||    ..||             
Human   225 GYGSGGGGAQQLGAGPFPAQ--PPGR--GFDLPPALASGSADAA----RKER------------- 268

  Fly   332 STSSYEPPTYS--SPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNP-----------GLHEWTG 383
            :..|..|||.:  |.||.:| ..|.::||.|:..||.........:|           ....|..
Human   269 ALDSPPPPTLACGSGGGSQG-DEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLT 332

  Fly   384 QVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR 448
            ..|.||||.||:|.||||||||||||.|:::::|.|::|::.||:|||||||||||||.||    
Human   333 AKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKK---- 393

  Fly   449 QANQQNNNNNSSSNHN 464
             .|::|.....::|.|
Human   394 -MNRENRIRELTANFN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)
HOXA10NP_061824.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..158 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..339 35/139 (25%)
Homeobox 339..392 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7588
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.