DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001295565.1 Gene:Hoxc10 / 315338 RGDID:1307250 Length:342 Species:Rattus norvegicus


Alignment Length:361 Identity:100/361 - (27%)
Similarity:150/361 - (41%) Gaps:88/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PQQQTPNSVAS-----------GASSNLQQQQQQQ-NAAVAPGQTQIVAPTTASVSPSSVSSQKE 220
            |:..||||.|.           ..|:.:..|.... |..|..|         ..::| |:|.:.|
  Rat     4 PRNVTPNSYAEPLAAPGGGERYNRSAGMYMQSGSDFNCGVMRG---------CGLAP-SLSKRDE 58

  Fly   221 --DINMSIQLAPLHIPAIRAGPGFETDTSAA------VKRHTAHWAYNDEGFNQHYGSGYYDRKH 277
              ..|:::...|.::..:.:.    .|..||      |.|..:..:|......::....|...|.
  Rat    59 GGSPNLALNTYPSYLSQLDSW----GDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKR 119

  Fly   278 --------MFAYPYPET-----QFPVGQYW--GPNYRP-DQTTSAAAA---------AAYMNEAE 317
                    ::::|.||:     :.||..|:  .|:|.. |:|...|.|         .|.:|...
  Rat   120 AKSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCAGANEFEAPFEQRASLNPRT 184

  Fly   318 RHVSA---AARQSVEGTSTSSYEPP------TYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCT 373
            .|:.:   ..:.|...|..|..:.|      |..|..|.:..|||:......:...|     |.|
  Rat   185 EHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLVGPKASPSESEKERAKTADSS-----PDT 244

  Fly   374 PNPGLHE----------WTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTE 428
            .:....|          |....|.||||.||:|.||||||||||||.|:::::|.|:::.:.||:
  Rat   245 SDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTD 309

  Fly   429 RQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHN 464
            |||||||||||||.||     .|::|.....:||.|
  Rat   310 RQVKIWFQNRRMKLKK-----MNRENRIRELTSNFN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
Hoxc10NP_001295565.1 COG5576 221..>331 CDD:227863 50/119 (42%)
Homeobox 271..325 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7402
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44776
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.