DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc13

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_235695.3 Gene:Hoxc13 / 315337 RGDID:1563984 Length:328 Species:Rattus norvegicus


Alignment Length:307 Identity:81/307 - (26%)
Similarity:117/307 - (38%) Gaps:91/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 AAVAPGQTQIVAPTTASVSPSSVSSQKEDI----NMSIQLAPL---------HIPAIRAG----- 239
            :..:||:    ||:...:..|..:|...|:    .::...|||         .|||..|.     
  Rat    45 SGASPGK----APSMDGLGGSCPASHCRDLLPHPVLARPPAPLGAPQGAVYTDIPAPEAARQCAP 105

  Fly   240 -PGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYY----------DRKHMFAYP---YPETQFPV 290
             |...|.:||.:            |:...:|..||          .:|....:|   |||   |.
  Rat   106 PPAPPTSSSATL------------GYGYPFGGSYYGCRLSHNVNLQQKPCSYHPGDKYPE---PS 155

  Fly   291 GQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPS--- 352
            |...|     |..:|.|...|:...     .|::.|::.|....|..|       |:.|:|.   
  Rat   156 GALPG-----DDLSSRAKEFAFYPS-----FASSYQAMPGYLDVSVVP-------GISGHPEPRH 203

  Fly   353 ------ENYSSSGASGGLSVGAVGPCTPNPGLHEWTG----------QVSV----RKKRKPYSKF 397
                  |.|.....|.|...........:...|.|..          :||.    ||||.||:|.
  Rat   204 DALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKV 268

  Fly   398 QTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            |..|||||:..:.:::|:||..::....|:||||.|||||||:|.||
  Rat   269 QLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
Hoxc13XP_235695.3 HoxA13_N 52..164 CDD:289085 29/131 (22%)
HOX 258..310 CDD:197696 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.