DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxa13b

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571269.2 Gene:hoxa13b / 30438 ZFINID:ZDB-GENE-980526-365 Length:289 Species:Danio rerio


Alignment Length:196 Identity:59/196 - (30%)
Similarity:80/196 - (40%) Gaps:36/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 PETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQ---------SVEGTSTSSYEP- 338
            |....|.| |:|.:|.|.:...:........|.....|.:..:         ..:|.|:..|:| 
Zfish    86 PSASLPYG-YFGGSYYPCRMPKSCTQPTTYGEKYMDTSVSGEEFPSRAKEFAFYQGYSSGPYQPV 149

  Fly   339 ---------PTYSSPGGLRG---YPSENYSSSGASGGLSVGAVGPCTPNPGLHEW---------- 381
                     |..|:|...|.   .|.|.|.....:.|.|.....|.........|          
Zfish   150 PSYLDVPVVPALSAPSEPRHESLLPVETYQPWAITNGWSSPVYCPKDQTQSSTLWKSSIQDTVSG 214

  Fly   382 TGQVSV---RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK 443
            |...||   ||||.||:|.|..|||:|:..|.:::|.||..::.:..||||||.|||||||:|.|
Zfish   215 TDGASVRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISAHTNLTERQVTIWFQNRRVKEK 279

  Fly   444 K 444
            |
Zfish   280 K 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 28/52 (54%)
hoxa13bNP_571269.2 HoxA13_N 27..129 CDD:289085 9/43 (21%)
Homeobox 226..279 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.