Sequence 1: | NP_001303472.1 | Gene: | Abd-B / 47763 | FlyBaseID: | FBgn0000015 | Length: | 493 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571269.2 | Gene: | hoxa13b / 30438 | ZFINID: | ZDB-GENE-980526-365 | Length: | 289 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 59/196 - (30%) |
---|---|---|---|
Similarity: | 80/196 - (40%) | Gaps: | 36/196 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 PETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQ---------SVEGTSTSSYEP- 338
Fly 339 ---------PTYSSPGGLRG---YPSENYSSSGASGGLSVGAVGPCTPNPGLHEW---------- 381
Fly 382 TGQVSV---RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK 443
Fly 444 K 444 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Abd-B | NP_001303472.1 | Homeobox | 390..443 | CDD:278475 | 28/52 (54%) |
hoxa13b | NP_571269.2 | HoxA13_N | 27..129 | CDD:289085 | 9/43 (21%) |
Homeobox | 226..279 | CDD:278475 | 28/52 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0487 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |