DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd13a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571244.2 Gene:hoxd13a / 30407 ZFINID:ZDB-GENE-990415-119 Length:256 Species:Danio rerio


Alignment Length:328 Identity:77/328 - (23%)
Similarity:116/328 - (35%) Gaps:124/328 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TPVAGALSPAQTPTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGA---SSNLQQQQQ-QQNAAVA 196
            |..|..||....||....:.    .||:.      ..|:::.||:   ..:|:...: .|||...
Zfish    26 TSGAPVLSAVDRPTSVCNES----ISPYF------SFPSNIGSGSFTFGCHLENSYKVPQNAVFP 80

  Fly   197 PGQTQIVAPTTAS-----VSPSSVSSQKEDINM------SIQLAP--LHIPAI-RAGPG-FETDT 246
            ||    ||.....     |.....||..::...      |....|  :.:|.: ||..| ...:|
Zfish    81 PG----VAKQNGQFANKPVDHGEASSWLKEFAFYQGCARSYPRIPAFIDLPVVQRAMMGDLRHET 141

  Fly   247 SAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAA 311
            ...::.| .||.:::...:|.|  .:.|          :|:.|  ..|.|:     .|..||||:
Zfish   142 CLTMEGH-QHWDWSNNCSSQLY--CFQD----------QTRSP--HIWKPS-----LTEEAAAAS 186

  Fly   312 YMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNP 376
            :..                                 ||                           
Zfish   187 FCQ---------------------------------RG--------------------------- 191

  Fly   377 GLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMK 441
                       ||||.||:|||..|||:|:....:::|:.|..:|.:..|:||||.|||||||:|
Zfish   192 -----------RKKRVPYTKFQLKELEREYNTTKFITKENRRRIASSTNLSERQVTIWFQNRRVK 245

  Fly   442 NKK 444
            :||
Zfish   246 DKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
hoxd13aNP_571244.2 HoxA13_N 16..>71 CDD:289085 12/54 (22%)
Homeobox 194..247 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.