DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd10a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571241.2 Gene:hoxd10a / 30404 ZFINID:ZDB-GENE-990415-116 Length:332 Species:Danio rerio


Alignment Length:334 Identity:94/334 - (28%)
Similarity:136/334 - (40%) Gaps:74/334 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LSPAQTPTGPSAQQQQHLTSPHHQQLPQQQT---PNSVASGASSNLQQQQQQQNAAVAPGQTQIV 203
            |.||....|....|...:|.  |..:||..|   |:     .|..|:|...|.:....   :|.:
Zfish    51 LLPALGKRGEVNHQNMDMTV--HSYIPQTDTWADPS-----RSCRLEQPLNQMSTCTF---SQSI 105

  Fly   204 APTT---------ASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGF--ETDTSAAVKRHTAHW 257
            ...|         |.||.|.:.:....|..|..:....||.    ||:  .:.|.|..|...   
Zfish   106 KEETNCCMYSDKRAKVSSSEIPAYSSLIPESCSVDSPEIPV----PGYFRLSQTYATAKNPD--- 163

  Fly   258 AYNDEGFNQHYGSGYYDRKHMFAY--PYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHV 320
             |::|..:.:......:|....|.  |:.|.:..:..        |:.|.:::.|   ...|..|
Zfish   164 -YDNETMSPNTTLMQLNRATPKAQSTPFVEVEKKLAH--------DRDTRSSSPA---QSPEPKV 216

  Fly   321 SAAARQ--SVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTG 383
            |....:  |.| .|.||.|.|...........|:.|                          |..
Zfish   217 STLEEKNCSTE-ASVSSPELPHREGKESKNDTPTSN--------------------------WLT 254

  Fly   384 QVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR 448
            ..|.||||.||:|.||||||||||||.|:::::|.|:::::.||:|||||||||||||.||.|:.
Zfish   255 AKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRE 319

  Fly   449 QANQQNNNN 457
            ...::..:|
Zfish   320 NRIRELTSN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
hoxd10aNP_571241.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..261 18/104 (17%)
COG5576 204..>321 CDD:227863 55/146 (38%)
Homeobox 261..314 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7557
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24582
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.