DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxa10b

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571230.2 Gene:hoxa10b / 30391 ZFINID:ZDB-GENE-990415-97 Length:347 Species:Danio rerio


Alignment Length:363 Identity:97/363 - (26%)
Similarity:149/363 - (41%) Gaps:110/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LQQQQQQQQQQLATTPVAGALSPAQT--PTGPSAQQQQHLTSPHHQQLPQQQTPNSVASGASSNL 184
            |::.:...|.   ..|..|.....:|  .|..|.:.:|    |::|..|:..:| ::....|..|
Zfish    72 LKRNESNSQN---VVPTCGPYQGMETWLETSRSCRIEQ----PNNQITPRSFSP-TIKEENSYCL 128

  Fly   185 QQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAG-----PGF-- 242
            .:.::      .|.:|                 ..|||:.| :|.|...|:....     ||:  
Zfish   129 YESEK------CPKET-----------------ITEDISYS-RLTPNSCPSSNNNGCVPVPGYFR 169

  Fly   243 --ETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRK----HMFAYPYPETQFPVGQYWGPNYRPD 301
              :|.|::                     .|:.|.:    |:.|  ...|:|            |
Zfish   170 LSQTCTTS---------------------KGFTDNQTIPTHVVA--QRSTRF------------D 199

  Fly   302 QTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYS--SPG------GLRGYPSENYSSS 358
            .:.||.||.|..:|::                   ||||.:  :||      |..|..|......
Zfish   200 SSLSAIAAEASRDESD-------------------EPPTCAPCAPGRNKELRGSTGTASSPEPPD 245

  Fly   359 GASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN 423
            .....::|...|. :.:.....|....|.||||.||:|.||||||||||||.|:::::|.|::|:
Zfish   246 SPEKAVTVTKAGD-SKSESTANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRS 309

  Fly   424 LQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSS 461
            :.||:|||||||||||||.||.|:....::.:.|.|.|
Zfish   310 VHLTDRQVKIWFQNRRMKLKKMSRENRIRELSANFSFS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)
hoxa10bNP_571230.2 Homeobox 276..329 CDD:306543 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7557
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24582
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.