DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd9a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571201.3 Gene:hoxd9a / 30350 ZFINID:ZDB-GENE-990415-121 Length:262 Species:Danio rerio


Alignment Length:310 Identity:90/310 - (29%)
Similarity:125/310 - (40%) Gaps:83/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SVASGASSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAP--------- 230
            |.:|..||..........|....|...|....||...||.| .:..|.: |...||         
Zfish     2 STSSALSSYYVDTIMGHEAEDVYGARYIQGSHTAPARPSGV-VENADFS-SCSFAPKSAVFPASW 64

  Fly   231 --LHIPAIRAGPG----FETDTSAAVKRHTAHWAYNDEGFNQHYG-SGYYDRKHMFAYPYPETQF 288
              :|.|:..|..|    :...|..:..|:...|.   |....|.. :|::               
Zfish    65 SSVHQPSTAAVSGIYHPYVHQTHLSDNRYVRSWI---EPVANHISLTGFH--------------- 111

  Fly   289 PVGQYWGPNYR----------PDQTTSAAAAAAYMNEAE---RHVSAAARQSVE---GTSTSSYE 337
                   ||.|          |.:|.|||......:..|   ..||.:|.::.|   |:..||: 
Zfish   112 -------PNSRHSGTKTESLPPKRTESAAFETETPSVPEFSLNAVSESADKATEERVGSDNSSH- 168

  Fly   338 PPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLEL 402
                       |.|.:.....         .:.|..|   ...|....|.||||.||:|:|||||
Zfish   169 -----------GEPKDEKQQQ---------QLDPSNP---AANWIHARSTRKKRCPYTKYQTLEL 210

  Fly   403 EKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452
            |||||:|.|:::.:|:|:||.|.||||||||||||||||.||.::.::::
Zfish   211 EKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRERSSK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 38/52 (73%)
hoxd9aNP_571201.3 Hox9_act 1..182 CDD:282473 44/227 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..187 21/125 (17%)
Homeobox 198..251 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7557
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm24582
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11042
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.