DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxb4a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:227 Identity:64/227 - (28%)
Similarity:105/227 - (46%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 SGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTS 334
            |.|.|.|    :| |..::....|. |::.||..::.....::.:|:..|..:........:...
Zfish    10 SNYVDPK----FP-PCEEYSQSDYL-PSHSPDYYSAQRQDPSFQHESIYHQRSGCADPPYSSCQG 68

  Fly   335 SYEPPTYSSPGGLRGY-------------PSENYSSSGASGGLSVGAVGPCTPN---------PG 377
            ..:|....||   ||:             ||.:..|...|...:.|.. |.:.|         |.
Zfish    69 PGQPAAVISP---RGHVLPTTALSTPLPEPSHHCDSVTPSPPPACGQT-PTSQNTSTVSSRKDPV 129

  Fly   378 LHEWTGQVSV------------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQ 430
            ::.|..:|.|            ::.|..|::.|.|||||||.:|.|:::::|.|:|..|.|:|||
Zfish   130 VYPWMKKVHVNIVSPNYSGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQ 194

  Fly   431 VKIWFQNRRMKNKKNSQRQANQQNNNNNSSSN 462
            :||||||||||.||: .:..|.:..:|::|:|
Zfish   195 IKIWFQNRRMKWKKD-HKLPNTKIRSNSASTN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 30/52 (58%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 18/106 (17%)
Antp-type hexapeptide 130..135 1/4 (25%)
Homeobox 154..207 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.