DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxb5a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:276 Identity:73/276 - (26%)
Similarity:120/276 - (43%) Gaps:98/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 GPGFE-----TDTSA-------AVKRHTAHWAYNDEGF----NQHYGSGYY----DRKHMFAYPY 283
            ||.::     |.:||       :...|:..:.||..|.    |:...:|::    |...:|..|.
Zfish    16 GPDYQLLNYGTSSSAMNASYRDSGTMHSGSYGYNYNGMDLSVNRSTSTGHFGAVGDNSRVFQSPA 80

  Fly   284 PETQF------------PV----GQYWGP---NYRPDQTTSA----------------AAAAAYM 313
            |||:|            |:    .:..||   :...||:|:.                |:|::..
Zfish    81 PETRFRQPSSCSLASPEPLPCSNSESLGPKGSSPPSDQSTTTAGNNLNSNTHFTEIDEASASSET 145

  Fly   314 NEAERHVSAAA---RQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPN 375
            .||....:.:|   :|..|.|:||                     ::|..|.|.:          
Zfish   146 EEASHRANNSAPRTQQKQETTATS---------------------TTSATSDGQA---------- 179

  Fly   376 PGLHEWTGQVSV---------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQV 431
            |.:..|..::.:         ::.|..|:::|||||||||.||.|:::::|.|:|..|.|:|||:
Zfish   180 PQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQI 244

  Fly   432 KIWFQNRRMKNKKNSQ 447
            ||||||||||.||:::
Zfish   245 KIWFQNRRMKWKKDNK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 26/141 (18%)
Antp-type hexapeptide 182..187 1/4 (25%)
Homeobox 204..256 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.