DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxd13

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001099356.1 Gene:Hoxd13 / 288154 RGDID:1308417 Length:331 Species:Rattus norvegicus


Alignment Length:350 Identity:94/350 - (26%)
Similarity:138/350 - (39%) Gaps:83/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 AGALSPAQTPTGPSA--QQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQQQNAAVAPGQTQ 201
            ||| :||.:.:..:|  |.:..|::|             |.:|..|..........||.|...:.
  Rat    11 AGA-APASSSSSVAAPGQCRGFLSAP-------------VFAGTHSGRAAAAAAAAAAAAAAASS 61

  Fly   202 IVAPTTASVSPSSVSSQKEDINMSIQLAPL--HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGF 264
            ...|.|:..:.||.||....:..:...||:  ..||..|..     |:||.....|      .|:
  Rat    62 FAYPGTSERTGSSSSSSSSAVIATRPEAPVAKECPAPAAAA-----TAAAPPGAPA------LGY 115

  Fly   265 NQHYGSGYY----------DRKHMFAYPYPET-QFPVGQYWGPNYRPDQTTSAAAAAAYMNEAER 318
            ..|:|:|||          .:..:.:.|:... .|||.:|.       ..:..|:::...||   
  Rat   116 GYHFGNGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYM-------DVSGLASSSVPTNE--- 170

  Fly   319 HVSAAARQSVEGTSTSSYEPPTYSSPGGL-------RGYP-------SENYSSSGASGGLSVGAV 369
             |.|.|:   |.:....|..|....||.:       .|.|       .|.|.|...:.|.:....
  Rat   171 -VPARAK---EVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVY 231

  Fly   370 GPCTPNPGLHEW----TGQVSV-----------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWE 419
            .......|.|.|    .|.|::           ||||.||:|.|..|||.|:..|.:::|.||..
  Rat   232 CAKDQPQGSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRR 296

  Fly   420 LARNLQLTERQVKIWFQNRRMKNKK 444
            ::....|:||||.|||||||:|:||
  Rat   297 ISAATNLSERQVTIWFQNRRVKDKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
Hoxd13NP_001099356.1 HoxA13_N <113..162 CDD:289085 11/55 (20%)
homeodomain 265..321 CDD:238039 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.