DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxb9

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001093967.1 Gene:Hoxb9 / 287647 RGDID:1306158 Length:250 Species:Rattus norvegicus


Alignment Length:233 Identity:77/233 - (33%)
Similarity:98/233 - (42%) Gaps:70/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 PETQFPVGQY-----------------------------WGP-----------NYRPDQTTSAAA 308
            |..:||.|||                             |.|           .|.|......|.
  Rat    24 PPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYLQPQGAP 88

  Fly   309 AA------AYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYS---SSGASGGL 364
            ||      .::..|.|..:|..    :|.:....| |...:||.|....:..||   |:|....|
  Rat    89 AAESRYLRTWLEPAPRAEAAPG----QGQAAVKAE-PLLGAPGELLKQGTPEYSLETSAGREAVL 148

  Fly   365 SVGAVG---------------PCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSK 414
            |....|               |...||..: |....|.||||.||:|:||||||||||||.|:::
  Rat   149 SNQRAGYGDNKICEGSEDKERPDQTNPSAN-WLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTR 212

  Fly   415 QKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ 452
            .:|.|:||.|.|:||||||||||||||.||.::.|..:
  Rat   213 DRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 38/52 (73%)
Hoxb9NP_001093967.1 Hox9_act 1..172 CDD:398350 30/152 (20%)
Homeobox 188..242 CDD:395001 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7402
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm44776
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.