DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc8

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:249 Identity:72/249 - (28%)
Similarity:94/249 - (37%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSA 322
            ||.|..|.|..|     |.|...|             ||          ..:|.....|..||..
  Rat    22 AYYDCRFPQSVG-----RSHALVY-------------GP----------GGSAPGFQHASHHVQD 58

  Fly   323 AARQSVEGTSTSSYE--PPTYSSPG------GLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH 379
            .......|.|.|.|:  |.:.|..|      |....|.:  |..||....||.....|..:...:
  Rat    59 FFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQ--SLYGAQQEASVVQYPDCKSSANTN 121

  Fly   380 EWTGQVSV--------------------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNL 424
            ...||..:                    |..|:.||::||||||||||||.|:::::|.|::..|
  Rat   122 SSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHAL 186

  Fly   425 QLTERQVKIWFQNRRMKNKKNS--------------QRQANQQNNNNNSSSNHN 464
            .||||||||||||||||.||.:              :.:.|::..........|
  Rat   187 GLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEEN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.