DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc4

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus


Alignment Length:212 Identity:65/212 - (30%)
Similarity:97/212 - (45%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AYNDEGFNQHYG----SGYYDRKHMFAYP-------YPETQFPVGQYWGPNYRPDQTTSAAAAAA 311
            :|..|...::||    || :...|...||       |||.|:......||.    .:.:...|.|
  Rat    27 SYIPEHSPEYYGRTRESG-FQHHHQELYPPPPPRPSYPERQYSCTSLQGPG----NSRAHGPAQA 86

  Fly   312 YMNEAERHVSAAARQSVEGTSTS-SYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPN 375
            ..:..|:.........:.|.|.| |..||..|.       |:.::.||.||            ..
  Rat    87 GHHHPEKSQPLCEPAPLSGASASPSPAPPACSQ-------PAPDHPSSAAS------------KQ 132

  Fly   376 PGLHEWTGQVSV------------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTE 428
            |.::.|..::.|            ::.|..|::.|.|||||||.:|.|:::::|.|:|.:|.|:|
  Rat   133 PIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSE 197

  Fly   429 RQVKIWFQNRRMKNKKN 445
            ||:||||||||||.||:
  Rat   198 RQIKIWFQNRRMKWKKD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 30/52 (58%)
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.