DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_034592.2 Gene:Hoxc10 / 209448 MGIID:96192 Length:342 Species:Mus musculus


Alignment Length:361 Identity:101/361 - (27%)
Similarity:149/361 - (41%) Gaps:88/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PQQQTPNSVA-------SGASSN-----LQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKE 220
            |:..||||.|       .|...|     ..|.....|..|..|         ..::| |:|.:.|
Mouse     4 PRNVTPNSYAEPLAAPGGGERYNRNAGMYMQSGSDFNCGVMRG---------CGLAP-SLSKRDE 58

  Fly   221 --DINMSIQLAPLHIPAIRAGPGFETDTSAA------VKRHTAHWAYNDEGFNQHYGSGYYDRKH 277
              ..|:::...|.::..:.:.    .|..||      |.|..:..:|......::....|...|.
Mouse    59 GGSPNLALNTYPSYLSQLDSW----GDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKR 119

  Fly   278 --------MFAYPYPET-----QFPVGQYW--GPNYRP-DQTTSAAAA---------AAYMNEAE 317
                    ::::|.||:     :.||..|:  .|:|.. |:|...|.|         .|.:|...
Mouse   120 AKSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCAGANEFEAPFEQRASLNPRT 184

  Fly   318 RHVSA---AARQSVEGTSTSSYEPP------TYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCT 373
            .|:.:   ..:.|...|..|..:.|      |..|..|.:..|||:......:...|     |.|
Mouse   185 EHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKASPSESEKERAKTADSS-----PDT 244

  Fly   374 PNPGLHE----------WTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTE 428
            .:....|          |....|.||||.||:|.||||||||||||.|:::::|.|:::.:.||:
Mouse   245 SDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTD 309

  Fly   429 RQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHN 464
            |||||||||||||.||     .|::|.....:||.|
Mouse   310 RQVKIWFQNRRMKLKK-----MNRENRIRELTSNFN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
Hoxc10NP_034592.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/15 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..271 18/89 (20%)
Homeobox 271..324 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7577
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42711
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.