DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Pou3f4

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_032927.1 Gene:Pou3f4 / 18994 MGIID:101894 Length:361 Species:Mus musculus


Alignment Length:451 Identity:94/451 - (20%)
Similarity:128/451 - (28%) Gaps:189/451 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AVVASSPSSVLQQQQQQSTPTTHSTPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQ-- 128
            |..||:|.|:|          :.|:..||..          |..||..|....|:.||....|  
Mouse     2 ATAASNPYSIL----------SSSSLVHADS----------AGMQQGSPFRNPQKLLQSDYLQGV 46

  Fly   129 --------------------QQQQLATTPVAGALSPAQTPTGPSAQQQQ-----HLTSPH--HQQ 166
                                ....|||:|:      .|....|..:..|     |..|||  |..
Mouse    47 PSNGHPLGHHWVTSLSDGGPWSSTLATSPL------DQQDVKPGREDLQLGAIIHHRSPHVAHHS 105

  Fly   167 LPQQQTPNSVASGAS----SNLQQQQQQQNAAVAPGQT--------QIVAPTTASVSPSSVSSQK 219
             |....||  |.|||    |::....|..|....||.|        .:..|      |::.|:|.
Mouse   106 -PHTNHPN--AWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPP------PAAASTQS 161

  Fly   220 EDINMSIQLAPLHIPAIRAGPGF--------------ETDTSAAVKRHTAHWAYNDEGFNQHYGS 270
                       || |.:|..|..              ||.||             ||  .:.:..
Mouse   162 -----------LH-PVLREPPDHGELGSHHCQDHSDEETPTS-------------DE--LEQFAK 199

  Fly   271 GYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSS 335
            .:..|:....:...:....:|..:|..:  .|||.....|                         
Mouse   200 QFKQRRIKLGFTQADVGLALGTLYGNVF--SQTTICRFEA------------------------- 237

  Fly   336 YEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEW-------TG---------- 383
                                        |.:.....|...|.|::|       ||          
Mouse   238 ----------------------------LQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAA 274

  Fly   384 QVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            |...||||..........||..||.....:.|:...||.:|||.:..|::||.|||.|.|:
Mouse   275 QGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 19/52 (37%)
Pou3f4NP_032927.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 12/34 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 13/78 (17%)
POU 186..260 CDD:197673 18/143 (13%)
Homeobox 281..335 CDD:395001 19/53 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..361 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.