DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Abd-B and lim-6

DIOPT Version :9

Sequence 1:	NP_001303472.1	Gene:	Abd-B / 47763	FlyBaseID:	FBgn0000015	Length:	493	Species:	Drosophila melanogaster
Sequence 2:	NP_001256980.1	Gene:	lim-6 / 180459	WormBaseID:	WBGene00002988	Length:	316	Species:	Caenorhabditis elegans

Alignment Length:	118	Identity:	25/118 - (21%)
Similarity:	47/118 - (39%)	Gaps:	38/118 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   379 HEWTGQVSVRKKRKPYSKFQTL---------------------------------ELEKEFLFNA 410
            |.:.|:|..|...:....|||:                                 :.:..|..::
Worm   145 HVFDGEVFCRNDYQSICNFQTISNPDPLMEEVVRSEIHRKTPKRPRTILNAQQRRQFKTAFERSS 209

  Fly   411 YVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNH 463
            ..|::.|.:||....|:.|.|::||||:|.|.||     .|::::::..:..|
Worm   210 KPSRKVREQLANETGLSVRVVQVWFQNQRAKIKK-----LNKKDSDSGDTFKH 257

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Abd-B	NP_001303472.1	Homeobox	390..443	CDD:278475	17/85 (20%)
lim-6	NP_001256980.1	LIM	42..95	CDD:295319
		LIM	101..157	CDD:295319	4/11 (36%)
		Homeobox	189..242	CDD:278475	14/52 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3844
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030