DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and nob-1

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001369824.1 Gene:nob-1 / 176641 WormBaseID:WBGene00003779 Length:243 Species:Caenorhabditis elegans


Alignment Length:284 Identity:76/284 - (26%)
Similarity:107/284 - (37%) Gaps:84/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 NLQQQQQQQNAAVAPGQTQIVAPTTASVSPS----SVSSQKEDINMSIQLAPLHIPAIRAGPGFE 243
            |....:..:.:..:..||....|:.|:..||    |.|.::.:...|.||||             
 Worm    10 NNDSPEDSKESITSVQQTPFFWPSAAAAIPSIQGESRSERESETGSSPQLAP------------- 61

  Fly   244 TDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQY-WGPNYRPDQTTSAA 307
             .::..|...||                                   |.| :||:..|    :|.
 Worm    62 -SSTGMVMPGTA-----------------------------------GMYGFGPSRMP----TAN 86

  Fly   308 AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYP---SENYSSSGASGGLS---- 365
            .....||.               ..|..|:.|..|:.....|.|   :.|||.....|.||    
 Worm    87 EFGMMMNP---------------VYTDFYQNPLASTGWYSYGQPYQFTANYSIPSLDGNLSDITI 136

  Fly   366 ---VGAVGPCTPNPGLH-EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQL 426
               .|:....|||..:| .|......:|||:||.|.|...||.|:..|.|::.::|.||:..|.|
 Worm   137 PTTAGSSAATTPNAAMHLPWAISHDGKKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLML 201

  Fly   427 TERQVKIWFQNRRMKNKKNSQRQA 450
            .|:|||:||||||||:||..||.:
 Worm   202 DEKQVKVWFQNRRMKDKKLRQRHS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 28/52 (54%)
nob-1NP_001369824.1 Homeobox 165..219 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm14172
orthoMCL 1 0.900 - - OOG6_111922
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.