powered by:
Protein Alignment Abd-B and Lmx1b
DIOPT Version :9
Sequence 1: | NP_001303472.1 |
Gene: | Abd-B / 47763 |
FlyBaseID: | FBgn0000015 |
Length: | 493 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006497809.1 |
Gene: | Lmx1b / 16917 |
MGIID: | 1100513 |
Length: | 408 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 22/74 - (29%) |
Similarity: | 39/74 - (52%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 RKKRKPYSKFQTLE---LEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
|:.::|.:...|.: .:..|..::...::.|..||....|:.|.|::||||:|.|.||.::|.
Mouse 223 RRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRH 287
Fly 450 ANQQNNNNN 458
..||...|:
Mouse 288 QQQQEQQNS 296
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3844 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.