DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxd4

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:252 Identity:75/252 - (29%)
Similarity:104/252 - (41%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 YNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA 323
            |..|....:||||........:..||...|....:.|....|.   ||..|..:           
Mouse    28 YLGEQGADYYGSGAQGADFQPSGLYPRPDFGEQPFGGGGPGPG---SALPARGH----------- 78

  Fly   324 ARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS------SGASGGLSVGAVGPCTPNPG----- 377
                       ..||   |.||...|.|.|...:      .||..  .....||..|.||     
Mouse    79 -----------GQEP---SGPGSHYGAPGERCPAPPPAPLPGARA--CSQPTGPKQPPPGTALKQ 127

  Fly   378 ---LHEWTGQVSV------------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLT 427
               ::.|..:|.|            ::.|..|::.|.|||||||.||.|:::::|.|:|..|.|:
Mouse   128 PAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLS 192

  Fly   428 ERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHA---QATQQHHSGHHLNLS 481
            |||:||||||||||.||: .:..|.:..:::|||..:.|   |..|.....||.:|:
Mouse   193 ERQIKIWFQNRRMKWKKD-HKLPNTKGRSSSSSSCSSSAAPGQHLQPMAKDHHTDLT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 31/52 (60%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 28/124 (23%)
Antp-type hexapeptide 131..136 1/4 (25%)
Homeobox 155..208 CDD:278475 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.