DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxd10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_006498852.1 Gene:Hoxd10 / 15430 MGIID:96202 Length:410 Species:Mus musculus


Alignment Length:361 Identity:98/361 - (27%)
Similarity:143/361 - (39%) Gaps:77/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PTGPSAQQQQHLTSPHHQQLPQQQTPNS------------VASGASSNLQQQQQQQNAAVAPGQT 200
            |:..|.|:.|.|   ..:.||:...|||            :::..|.:.................
Mouse    52 PSDVSLQRTQSL---FFKFLPKMSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADM 113

  Fly   201 QIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDT------------------- 246
            ......|..:.||....:....||.:.:.| :||.:.:.    ||.                   
Mouse   114 GTYGMQTCGLLPSLAKREVNHQNMGMNVHP-YIPQVDSW----TDPNRSCRIEQPVTQQVPTCSF 173

  Fly   247 SAAVKRHTAHWAYNDEGFNQHYGSGY--YDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAA 309
            :|.:|..:....|:|:. |:...:..  |.|....:.|....:.||..|    :|..||.:....
Mouse   174 TANIKEESNCCMYSDKR-NKLISAEVPSYQRLVPESCPVENPEVPVPGY----FRLSQTYATGKT 233

  Fly   310 AAYMNE----------------AERHVSAAARQSVE--GTSTSSYEPPTYS---SPGGLRGYPSE 353
            ..|.|.                |:..:|||..|..:  ..|.|..||...|   ||....|.|.:
Mouse   234 QEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNESASGQEPTKVSQVESPEAKGGLPED 298

  Fly   354 -------NYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAY 411
                   :.||.......|...:...||.   ..|....|.||||.||:|.||||||||||||.|
Mouse   299 RSCLAEVSVSSPEVQEKESKEEIKSDTPT---SNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY 360

  Fly   412 VSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQ 447
            :::::|.|:::::.||:|||||||||||||.||.|:
Mouse   361 LTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
Hoxd10XP_006498852.1 Homeobox 339..393 CDD:365835 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7577
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42711
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.