DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc9

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_032298.1 Gene:Hoxc9 / 15427 MGIID:96199 Length:260 Species:Mus musculus


Alignment Length:280 Identity:91/280 - (32%)
Similarity:123/280 - (43%) Gaps:70/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SSVSSQKEDINMSIQLAPLHIPAIRAGP------GFETDTS----------AAVKRHTAHWA--- 258
            |.:|...||:..|      ..||..|.|      |...|.|          .||  .:..||   
Mouse    14 SLISHDNEDLLAS------RFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAV--FSTSWAPVP 70

  Fly   259 ------YNDEGFNQHYGSGYYDRKHMFAYPYPET------QFPVGQYWGPNY--RPDQTTSAAAA 309
                  |:..|...|.|:   |.::|..:..|.:      .||.|   |.:|  :||        
Mouse    71 SQSSVVYHPYGPQPHLGA---DTRYMRTWLEPLSGAVSFPSFPAG---GRHYALKPD-------- 121

  Fly   310 AAYMNEAERHVSAAARQSVEGTSTS-SYEPPTYSSPGGLRGYPSENYSSSGA---SGGLSVGAVG 370
             ||          ..|::..|.... ||....|.|||.||....:...|..|   :|........
Mouse   122 -AY----------PGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKA 175

  Fly   371 PCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWF 435
            ...|:..:..|....|.||||.||:|:||||||||||||.|:::.:|:|:||.|.||||||||||
Mouse   176 DLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWF 240

  Fly   436 QNRRMKNKKNSQRQANQQNN 455
            ||||||.||.::.:.:::.:
Mouse   241 QNRRMKMKKMNKEKTDKEQS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 39/52 (75%)
Hoxc9NP_032298.1 Hox9_act 1..179 CDD:398350 45/197 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..182 18/80 (23%)
HOX 192..241 CDD:197696 34/48 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7577
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.