DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc5

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:223 Identity:73/223 - (32%)
Similarity:106/223 - (47%) Gaps:48/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AYNDEGFNQHYGS-----------GYYDRKHMFAYPYPETQF-PVGQYWGPNYRPDQTTSAAAA- 309
            |||.:... :|||           |..|....|..|.|.... .|.....|...||:...:||| 
Mouse    18 AYNMQTCG-NYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAAA 81

  Fly   310 ---------AAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLS 365
                     ||.:|.. .:...|||.::|..:.||             |...|..:.:|...|||
Mouse    82 PGHALGRDEAAPLNPG-MYSQKAARPALEERAKSS-------------GEIKEEQAQTGQPAGLS 132

  Fly   366 VGAVGPCTPNPGLHEWTGQVSV------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNL 424
                .|..| |.::.|..::.:      ::.|..|:::|||||||||.||.|:::::|.|:|.||
Mouse   133 ----QPPAP-PQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNL 192

  Fly   425 QLTERQVKIWFQNRRMKNKKNSQRQANQ 452
            .|.|||:||||||||||.||:|:.::.:
Mouse   193 CLNERQIKIWFQNRRMKWKKDSKMKSKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 33/52 (63%)
Hoxc5NP_783857.1 COG5373 65..>142 CDD:227665 24/95 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 23/91 (25%)
Antp-type hexapeptide 140..145 1/4 (25%)
Homeobox 158..212 CDD:395001 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.