DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc12

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_034593.1 Gene:Hoxc12 / 15421 MGIID:96194 Length:280 Species:Mus musculus


Alignment Length:318 Identity:84/318 - (26%)
Similarity:121/318 - (38%) Gaps:128/318 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PSAQ-----QQQHLTSPHHQQLPQQQT-------------PNSVASGASSNLQQQQQQQNAAVAP 197
            |||:     .|.:|.||.....|..:|             ....|.|....|:::::.:.....|
Mouse    56 PSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDSKGYYREPCAEGGGGGLKREERGREPGAGP 120

  Fly   198 GQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDE 262
            |..                        .:||.|...||:    ||:.|       :||.....| 
Mouse   121 GAA------------------------LLQLEPSGPPAL----GFKYD-------YTASGGGGD- 149

  Fly   263 GFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPD--QTTSAAAAAAYMNEAERHVSAAAR 325
                  ||                       .||.:.|.  |:..:.::::.:||..:..||.  
Mouse   150 ------GS-----------------------TGPPHDPPSCQSLESDSSSSLLNEGNKSASAG-- 183

  Fly   326 QSVEGTSTSSYEPPTYSSP----GGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVS 386
                       :|.:..||    |||        |:|||          |..|   :|..:    
Mouse   184 -----------DPGSLVSPLNPGGGL--------SASGA----------PWYP---IHSRS---- 212

  Fly   387 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
             |||||||||.|..|||.|||.|.::::|:|.||:..|.|:::||||||||||||.|:
Mouse   213 -RKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 33/52 (63%)
Hoxc12NP_034593.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..212 39/215 (18%)
homeodomain 213..269 CDD:238039 35/55 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.