DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxb5

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:228 Identity:67/228 - (29%)
Similarity:101/228 - (44%) Gaps:47/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 HTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAA---------- 307
            ||..:.||..|.:...........|..|.......||.... .|.:|  |.||:.          
Mouse    41 HTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPASAQ-EPRFR--QATSSCSLSSPESLPC 102

  Fly   308 ----------AAAAYMNEAERHVSAAARQSVEGTSTSSYEP----PTYSSPGGLRGYPSENYSSS 358
                      :|::..::|....|:|....::..|.|| ||    ...|||...|..|....:|:
Mouse   103 TNGDSHGAKPSASSPSDQATPASSSANFTEIDEASASS-EPEEAASQLSSPSLARAQPEPMATST 166

  Fly   359 GASGGLSVGAVGPCTPNPGLHEWTGQVSV---------RKKRKPYSKFQTLELEKEFLFNAYVSK 414
            .|..|          ..|.:..|..::.:         ::.|..|:::|||||||||.||.|:::
Mouse   167 AAPEG----------QTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTR 221

  Fly   415 QKRWELARNLQLTERQVKIWFQNRRMKNKKNSQ 447
            ::|.|:|..|.|:|||:||||||||||.||:::
Mouse   222 RRRIEIAHALCLSERQIKIWFQNRRMKWKKDNK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 24/111 (22%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 198..251 CDD:365835 32/52 (62%)
PRK07003 <67..>171 CDD:235906 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.