DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxa9

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001264167.1 Gene:Hoxa9 / 15405 MGIID:96180 Length:295 Species:Mus musculus


Alignment Length:103 Identity:55/103 - (53%)
Similarity:67/103 - (65%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 PSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQ 415
            |||...|...:...|.|...|..||.....|....|.||||.||:|.||||||||||||.|:::.
Mouse   193 PSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRD 257

  Fly   416 KRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQ 453
            :|:|:||.|.||||||||||||||||.||.::.:|..:
Mouse   258 RRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 39/52 (75%)
Hoxa9NP_001264167.1 Hox9_act <190..216 CDD:282473 7/22 (32%)
Homeobox 232..285 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7577
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm42711
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.