DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxa7

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001406200.1 Gene:Hoxa7 / 15404 MGIID:96179 Length:270 Species:Mus musculus


Alignment Length:107 Identity:43/107 - (40%)
Similarity:63/107 - (58%) Gaps:17/107 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 PGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLF 408
            ||.|..:.:..:..:||...   |..||              ..::.|:.|:::|||||||||.|
Mouse   144 PGSLTHHCTRGHFQNGAEAN---GTEGP--------------DRKRGRQTYTRYQTLELEKEFHF 191

  Fly   409 NAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQA 450
            |.|:::::|.|:|..|.|||||:||||||||||.||..:.::
Mouse   192 NRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDES 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649 33/55 (60%)
Hoxa7NP_001406200.1 Homeodomain 171..227 CDD:459649 33/55 (60%)

Return to query results.
Submit another query.