DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxa5

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus


Alignment Length:284 Identity:73/284 - (25%)
Similarity:110/284 - (38%) Gaps:105/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGF--------NQHYG 269
            ||||.|..|                         ||::  |:..:.|...|.        :.|:|
Mouse    28 SSVSEQFRD-------------------------SASM--HSGRYGYGYNGMDLSVGRSGSGHFG 65

  Fly   270 SGYYDRKH-----------MFAYPYPETQFPVGQYWGPNYRPDQTTSAAAA-------------- 309
            ||...|.:           .::.|...|..|         .||....:|.|              
Mouse    66 SGERARSYAAGASAAPAEPRYSQPATSTHSP---------PPDPLPCSAVAPSPGSDSHHGGKNS 121

  Fly   310 -----AAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAV 369
                 .|..|....|:|  :|:.|...|.:..:.|..|...|.:..||                 
Mouse   122 LGNSSGASANAGSTHIS--SREGVGTASAAEEDAPASSEQAGAQSEPS----------------- 167

  Fly   370 GPCTP-NPGLHEWTGQVSV----------RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN 423
             |..| .|.::.|..::.:          ::.|..|:::|||||||||.||.|:::::|.|:|..
Mouse   168 -PAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 231

  Fly   424 LQLTERQVKIWFQNRRMKNKKNSQ 447
            |.|:|||:||||||||||.||:::
Mouse   232 LCLSERQIKIWFQNRRMKWKKDNK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 21/128 (16%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeobox 199..252 CDD:333795 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.