DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Dlx1

DIOPT Version :10

Sequence 1:NP_524896.2 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_034183.1 Gene:Dlx1 / 13390 MGIID:94901 Length:255 Species:Mus musculus


Alignment Length:50 Identity:13/50 - (26%)
Similarity:19/50 - (38%) Gaps:11/50 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QQDQSRSRVKVIKVLPMVAGEQFLDDPQTYNEF-DFLNHLRGTIGVPNII 80
            ||:|:....:|.|          ..|.:.|.|| ||......|..:.|.:
Mouse    16 QQNQTAGEPEVPK----------RSDVKVYKEFCDFYVRYNMTNALANAV 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_524896.2 Homeodomain 388..444 CDD:459649
Dlx1NP_034183.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..118
Homeodomain 129..185 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..233
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.