DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and HOXB13

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_006352.2 Gene:HOXB13 / 10481 HGNCID:5112 Length:284 Species:Homo sapiens


Alignment Length:300 Identity:78/300 - (26%)
Similarity:116/300 - (38%) Gaps:98/300 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 APGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPA-------IRAGPGFETDTSAAVKRH 253
            |.|...:||.:..:..|::.:     :..::..|||.:|.       ....||....||.|    
Human    21 AGGGRNLVAHSPLTSHPAAPT-----LMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPA---- 76

  Fly   254 TAHWAYNDEGFNQHYGSGYYDRK-------------HMFAYP---------YPE--TQFPVGQYW 294
            ...:.|        :|.|||..:             .:.|||         ||.  |:|.....:
Human    77 PVPYGY--------FGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGY 133

  Fly   295 GPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRG---YPSENYS 356
            ...|:|        .|:|::     ||..               .|..:||..|.   .|.::|.
Human   134 PGTYQP--------MASYLD-----VSVV---------------QTLGAPGEPRHDSLLPVDSYQ 170

  Fly   357 SSGASGGLS-----VGAVGPCTPNP----GLHEWTGQVSV--------RKKRKPYSKFQTLELEK 404
            |...:||.:     .|...|  |.|    ...:.:||...        ||||.||||.|..|||:
Human   171 SWALAGGWNSQMCCQGEQNP--PGPFWKAAFADSSGQHPPDACAFRRGRKKRIPYSKGQLRELER 233

  Fly   405 EFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            |:..|.:::|.||.:::....|:|||:.|||||||:|.||
Human   234 EYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 27/52 (52%)
HOXB13NP_006352.2 HoxA13_N 12..121 CDD:372013 22/116 (19%)
HOX 216..272 CDD:197696 29/55 (53%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 217..246 15/28 (54%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 258..269 8/10 (80%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536, ECO:0000305|Ref.8 270..273 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.