DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxa11

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001123350.1 Gene:Hoxa11 / 103692131 RGDID:1564605 Length:313 Species:Rattus norvegicus


Alignment Length:330 Identity:95/330 - (28%)
Similarity:137/330 - (41%) Gaps:96/330 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 HLTSPHHQQLPQ--QQTPNS--VASGASSNLQQQQQQQNA-----AVAPG--------------- 198
            :::.|....||.  .|||:|  :....||||.|.|..:..     |:.|.               
  Rat    22 YVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSA 86

  Fly   199 -----QTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWA 258
                 :..:.||:.|.| |..|.: |...|:      .|.|.    |...::..:.|.|:    .
  Rat    87 EELVHRDCLQAPSAAGV-PGDVLA-KSSANV------YHHPT----PAVSSNFYSTVGRN----G 135

  Fly   259 YNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA 323
            ...:.|:|.:.:.|...:::.:..||..:         |......|:||.:||       .|:||
  Rat   136 VLPQAFDQFFETAYGTPENLASSDYPGDK---------NAEKGPPTAAATSAA-------AVAAA 184

  Fly   324 ARQSVEGTSTSSYEPPTYSSPGG--------------LRGYPSENYSSSGASGGLSVGAVGPCTP 374
            |..:          |.|.||.||              .|..|..:.|...:||.....|.|    
  Rat   185 ATGA----------PATSSSDGGGGGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGG---- 235

  Fly   375 NPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRR 439
                   :|....||||.||:|:|..|||:||.|:.|::|:||.:|:|.|.||:|||||||||||
  Rat   236 -------SGGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRR 293

  Fly   440 MKNKK 444
            ||.||
  Rat   294 MKEKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 34/52 (65%)
Hoxa11NP_001123350.1 DUF3528 26..162 CDD:403310 32/151 (21%)
Homeobox 244..298 CDD:395001 34/53 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44776
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.