DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxd11

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_008760183.3 Gene:Hoxd11 / 102553842 RGDID:7730597 Length:336 Species:Rattus norvegicus


Alignment Length:336 Identity:96/336 - (28%)
Similarity:124/336 - (36%) Gaps:119/336 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PGQTQIVAPTTASVSPSSVSSQKEDINM----SIQLAPLHIPAIR----AGPGFETDTSAAVKRH 253
            ||....|||:..:..||.: ||.....|    |..||| |:..:|    ...|.|          
  Rat    17 PGCAYYVAPSDFASKPSFL-SQPSSCQMTFPYSSNLAP-HVQPVREVAFRDYGLE---------- 69

  Fly   254 TAHWAYNDEGFNQHYGSG----------------YY--------------------------DRK 276
            .|.|.|...|.....|.|                ||                          .|:
  Rat    70 RAKWPYRGGGGGGAGGGGGGGPGGGGGGSGGYAPYYAAAAAAAAAAAAAEEAAMQRDLLPPAGRR 134

  Fly   277 HMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAAR------------QSVE 329
            ....:..||   ||....||.:.|     ||||:.:       .||..|            ::..
  Rat   135 PDVLFKAPE---PVCGAPGPPHGP-----AAAASNF-------YSAVGRNGILPQGFDQFYEAAP 184

  Fly   330 GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPC---TPNP--------------- 376
            |...:..:|....:|....|...:....:||.|    |...||   ||.|               
  Rat   185 GPPFAGPQPQPAPAPPQPEGAADKGDPKAGAGG----GGGSPCSKATPGPEPKGAAEGGGGEGEG 245

  Fly   377 -----GLHEWTGQVS---VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKI 433
                 |..:..|.|:   .||||.||:|:|..|||:||.||.|::|:||.:|:|.|.||:|||||
  Rat   246 PPGEAGAEKSGGTVAPQRSRKKRCPYTKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKI 310

  Fly   434 WFQNRRMKNKK 444
            ||||||||.||
  Rat   311 WFQNRRMKEKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
Hoxd11XP_008760183.3 DUF3528 26..187 CDD:403310 37/187 (20%)
Homeobox 267..321 CDD:395001 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7402
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm44776
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.