DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxa7

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001363856.1 Gene:hoxa7 / 101734257 XenbaseID:XB-GENE-483655 Length:207 Species:Xenopus tropicalis


Alignment Length:217 Identity:64/217 - (29%)
Similarity:92/217 - (42%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 SGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTST- 333
            |.||.......|....:.||     .|...|....|.:....|                 ||.| 
 Frog     3 SSYYVSALFSKYTAGASLFP-----NPESTPCSLASNSQRGGY-----------------GTGTG 45

  Fly   334 -------SSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNP-----GLHE------ 380
                   |.|..|.|.:|.......|::|:...:|...::..:  |...|     .||:      
 Frog    46 PFPSSVPSLYNSPLYQNPFPAYSLASDSYNLHCSSFDQNIPLL--CNELPKAEEAALHQQADSHF 108

  Fly   381 ----WTGQVSVRKK--RKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRR 439
                |.......:|  |:.|:::|||||||||.||.|:::::|.|:|..|.|||||:||||||||
 Frog   109 RIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRR 173

  Fly   440 MKNKKNSQRQANQQNNNNNSSS 461
            ||.||..:.::.|..:....|:
 Frog   174 MKWKKEHKEESGQTPDAGEDST 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 34/54 (63%)
hoxa7NP_001363856.1 Homeobox 125..178 CDD:365835 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.