DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and Hoxc11

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_038934166.1 Gene:Hoxc11 / 100911859 RGDID:6489991 Length:329 Species:Rattus norvegicus


Alignment Length:194 Identity:40/194 - (20%)
Similarity:69/194 - (35%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HHH--AHHHLPQPLHTTSHHHSAHPHLQQQQQQQQHAVVASSPSS--VLQQQQQQSTPTTHSTPT 92
            |||  |.|..|...:::.:.:|..|....:.....:.....:|:.  ...:.:.:..|       
  Rat   124 HHHPSAPHAAPAGFYSSVNKNSVLPQAFDRFFDNAYCGGGDAPAEPPCSGKGEAKGEP------- 181

  Fly    93 HAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVAGALSPAQTPTGPSAQQQQ 157
                 |.||...|.:..:....|..:::................|..|| :|::.|..|      
  Rat   182 -----EAPPASGLASRAEAGAEAEAEEENTNPSSSGSSHSATKEPAKGA-APSRRPPNP------ 234

  Fly   158 HLTSPHHQQLPQQQTPNSVASGASSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKED 221
                  .:.||..:.|:. .:||...||:..||:.||.|....:...||    |.:.||.||.:
  Rat   235 ------QEALPLFEIPDP-GTGARVFLQRVHQQREAAAAVPHAEPDRPT----SENLVSEQKNE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475
Hoxc11XP_038934166.1 DUF3528 42..178 CDD:403310 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44776
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.