DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd9

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_012826755.2 Gene:hoxd9 / 100497640 XenbaseID:XB-GENE-485791 Length:278 Species:Xenopus tropicalis


Alignment Length:79 Identity:48/79 - (60%)
Similarity:60/79 - (75%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNR 438
            ||.....|....|.||||.||:|:||||||||||||.|:::.:|:|:||.|.|||||||||||||
 Frog   198 PNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNR 262

  Fly   439 RMKNKKNSQRQANQ 452
            |||.||.::.:.|:
 Frog   263 RMKMKKMNKEKGNK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 39/52 (75%)
hoxd9XP_012826755.2 Hox9_act 1..181 CDD:398350
HOX 211..260 CDD:197696 34/48 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7474
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm47815
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.