DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxb8

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_002938067.1 Gene:hoxb8 / 100493882 XenbaseID:XB-GENE-990961 Length:243 Species:Xenopus tropicalis


Alignment Length:218 Identity:71/218 - (32%)
Similarity:97/218 - (44%) Gaps:57/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 TQFPVGQYWGPNY-----------RPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPP 339
            :::..|....|||           ||.....|:|...:.:..:      .:....|  |.|...|
 Frog    11 SKYKTGDSLRPNYYDCGFAQDLGGRPTVVYGASAGGTFQHPGQ------IQDFYHG--TPSLSSP 67

  Fly   340 TY----------SSPGGLRGY-PSEN---YSSSG-----------ASGGLSVGA-VGPCTPNP-G 377
            ||          ..||...|| |.:.   :||..           ||.||...| ....:|:| .
 Frog    68 TYQQNPCAVTCHGDPGSFYGYDPLQRQSLFSSQDTELVQYSECKLASAGLGEEAESSEQSPSPTQ 132

  Fly   378 LHEW---TGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRR 439
            |..|   ......|:.|:.||::||||||||||||.|:::::|.|::..|.||||||||||||||
 Frog   133 LFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRR 197

  Fly   440 MKNKKNSQRQANQQNNNNNSSSN 462
            ||.||        :||.:...|:
 Frog   198 MKWKK--------ENNKDKFPSS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 35/52 (67%)
hoxb8XP_002938067.1 Homeobox 149..202 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.