DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd8

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001135589.1 Gene:hoxd8 / 100216142 XenbaseID:XB-GENE-920113 Length:231 Species:Xenopus tropicalis


Alignment Length:290 Identity:77/290 - (26%)
Similarity:111/290 - (38%) Gaps:99/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 VAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAY 259
            |..|:..:|...:.|.:|...               .|.|.....||::......    |.|   
 Frog    30 VGSGRAPLVYSGSGSGAPQDY---------------YHHPGTLPSPGYQPAPCGI----TCH--- 72

  Fly   260 NDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAA-----YMNEAERH 319
            .|..  :.||..::.|:|:|. .:.|.: || ||      ||..:.:|:..|     :.|....|
 Frog    73 GDPA--KLYGYDHFQRQHIFT-THQEAE-PV-QY------PDCKSPSASIGADPEHLHQNSPASH 126

  Fly   320 VSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQ 384
            :....|..|              :||..||                                   
 Frog   127 MFPWMRAQV--------------APGRRRG----------------------------------- 142

  Fly   385 VSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
                  |:.||:|||||||||||||.|:::::|.|::..|.||||||||||||||||.||.:.:.
 Frog   143 ------RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENSKD 201

  Fly   450 ----ANQQNNNNNSSSNHNHAQATQQHHSG 475
                ::|:...........|.:  ||...|
 Frog   202 KFPVSSQEGKEEADKKGGLHQE--QQGREG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)
hoxd8NP_001135589.1 Homeobox 143..196 CDD:365835 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976319at2759
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.