DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd10

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_031749087.1 Gene:hoxd10 / 100038085 XenbaseID:XB-GENE-485204 Length:274 Species:Xenopus tropicalis


Alignment Length:316 Identity:86/316 - (27%)
Similarity:123/316 - (38%) Gaps:113/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 SGASSNLQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAP--LHIPAIRAGP 240
            |.::||:          ..||....|:|:..| |.||..||.....|::..:.  .|:..:|   
 Frog     8 SNSASNM----------YLPGCAYYVSPSDFS-SKSSFFSQSSSCPMTLSYSSNLTHVQPVR--- 58

  Fly   241 GFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWG--PNYRPDQT 303
                                :..|.:              |....|::   ||.|  |:|     
 Frog    59 --------------------EVAFRE--------------YGLERTKW---QYRGTYPSY----- 81

  Fly   304 TSAAAAAAYMNEAERH---VSAAARQS---VEGTSTSSYE-PPT-----YSSPG--GLRGYPSEN 354
                    |.:|...|   :..|.|:|   .:..|..::. ||:     |||.|  |:.....:.
 Frog    82 --------YPSEEVMHRDLIQPANRRSDMLFKSDSVCNHHGPPSSQSNFYSSVGRNGILPQGFDQ 138

  Fly   355 YSSSGASGGLSVGA-----------------------------VGPCTPNPGLHEWTGQVS--VR 388
            :..|..:.|..||.                             ..|.||:....:.....|  :|
 Frog   139 FYDSSQNQGYQVGMEEQPAKSDPKATNAPTKAPSTQDKKVTNDSSPGTPSGEAEKSNSSASQRLR 203

  Fly   389 KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444
            |||.||||:|..|||:||.||.|::|:||.:|:|.|.||:|||||||||||||.||
 Frog   204 KKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 36/52 (69%)
hoxd10XP_031749087.1 DUF3528 41..163 CDD:403310 29/174 (17%)
Homeobox 205..259 CDD:395001 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414477at33208
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm47815
Panther 1 1.100 - - O PTHR45874
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.