DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abd-B and hoxd12a

DIOPT Version :9

Sequence 1:NP_001303472.1 Gene:Abd-B / 47763 FlyBaseID:FBgn0000015 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001119958.1 Gene:hoxd12a / 100006598 ZFINID:ZDB-GENE-990415-118 Length:277 Species:Danio rerio


Alignment Length:238 Identity:69/238 - (28%)
Similarity:98/238 - (41%) Gaps:71/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 YDRKHMFAYPYPETQFPVGQYWGPNY----RPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTST 333
            |.|:.:.:.|:..:...........|    :|..:.|||.:|:.....:..:..:.|...:..|.
Zfish    44 YSRREVCSLPWSSSNSCTAPAQSRAYSGYSQPFFSNSAAVSASLNTHKKGSLEESGRYYFQDVSH 108

  Fly   334 SSYEPPTYSSPGGLRGYPSENYSS--SGASGGLS------VGAVGP----CTPNP---------- 376
            .|.||          |.|:..|:|  |.||.|||      :.||.|    |...|          
Zfish   109 KSEEP----------GRPNAAYASEQSSASNGLSNLERRQLNAVAPNELSCIEQPESDASKQSVS 163

  Fly   377 -----------------------------------GLHEWTGQVSVRKKRKPYSKFQTLELEKEF 406
                                               ||.....||..|||||||:|.|..|||.||
Zfish   164 SIAPFQPSLSAQNIRPAFTDGTLNFSNDPSAIDTNGLPWCPSQVRSRKKRKPYTKPQLTELENEF 228

  Fly   407 LFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQ 449
            :.|.::::|||.||:..|:|:::||||||||||||.|:...|:
Zfish   229 MMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRLMMRE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abd-BNP_001303472.1 Homeobox 390..443 CDD:278475 32/52 (62%)
hoxd12aNP_001119958.1 Homeobox 212..265 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0487
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.