DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and FPR1

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_014264.1 Gene:FPR1 / 855587 SGDID:S000005079 Length:114 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:45/106 - (42%)
Similarity:69/106 - (65%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGV 76
            :|.|..:.:..|.|...|.:|..|::||||.|.:|.:||||:.|..||:.::|.|.|||.:|:|:
Yeast     6 EGNVKIDRISPGDGATFPKTGDLVTIHYTGTLENGQKFDSSVDRGSPFQCNIGVGQVIKGWDVGI 70

  Fly    77 ATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEML 117
            ..:.:||:..||....||||..|.|..|||::||:|::|:|
Yeast    71 PKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 41/91 (45%)
ppisom_GldI <124..233 CDD:132555
BamD 252..>390 CDD:276939
TPR_12 252..329 CDD:290160
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939
TPR repeat 296..326 CDD:276809
TPR_11 299..362 CDD:290150
TPR repeat 329..361 CDD:276939
TPR_1 331..364 CDD:278916
TPR repeat 331..359 CDD:276809
FPR1NP_014264.1 FkpA <1..114 CDD:223619 45/106 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100299
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.