DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and FKBP6

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_003593.3 Gene:FKBP6 / 8468 HGNCID:3722 Length:327 Species:Homo sapiens


Alignment Length:397 Identity:91/397 - (22%)
Similarity:153/397 - (38%) Gaps:121/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRL--VDGTEFDSSLSRNEPFEFSLGKGNVI 69
            :|:|||.||||::::||.| :......:|.:.|:|.|  :| ..|||:..|..|....||:...:
Human    30 LDISGDRGVLKDVIREGAG-DLVAPDASVLVKYSGYLEHMD-RPFDSNYFRKTPRLMKLGEDITL 92

  Fly    70 KAFDMGVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEMLGWKGEDLSPNQDGSIDR 134
            ...::|:.:|:.||.......||||||..|.||.|||:.|::||:|:|.                
Human    93 WGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLD---------------- 141

  Fly   135 TILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAIGIIDGVEIALEK-MNVGET 198
                            |:....|..|.....|.:|                 :..|:| :.|..|
Human   142 ----------------FLDCAESDKFCALSAEQQD-----------------QFPLQKVLKVAAT 173

  Fly   199 SRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKLSDEERLAEAKVYKEKGTNYF 263
            .|          ..||..|:                           :.|..:|||..::.....
Human   174 ER----------EFGNYLFR---------------------------QNRFYDAKVRYKRALLLL 201

  Fly   264 KK-------ENWALAIKMYTKCKNILPTTVHTNEEVKKIKVATHSNIALCHQKSNDHFEAKQECN 321
            ::       ::...|.|        ||..::.:....|:...|   ||||:.:            
Human   202 RRRSAPPEEQHLVEAAK--------LPVLLNLSFTYLKLDRPT---IALCYGE------------ 243

  Fly   322 EVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEK 386
            :.|.:|:.|.|||:|.||..|.:.|.:.|.:...:..:.:|.|....|::.......::..:|||
Human   244 QALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQKEQPFNHDINNELKKLASCYRDYVDKEK 308

  Fly   387 KLYANMF 393
            :::..||
Human   309 EMWHRMF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 33/93 (35%)
ppisom_GldI <124..233 CDD:132555 13/109 (12%)
BamD 252..>390 CDD:276939 31/144 (22%)
TPR_12 252..329 CDD:290160 15/83 (18%)
TPR repeat 252..280 CDD:276939 5/34 (15%)
TPR repeat 252..280 CDD:276809 5/34 (15%)
TPR repeat 287..326 CDD:276939 7/38 (18%)
TPR repeat 296..326 CDD:276809 6/29 (21%)
TPR_11 299..362 CDD:290150 17/62 (27%)
TPR repeat 329..361 CDD:276939 10/31 (32%)
TPR_1 331..364 CDD:278916 10/32 (31%)
TPR repeat 331..359 CDD:276809 9/27 (33%)
FKBP6NP_003593.3 FKBP_C 51..140 CDD:306713 32/89 (36%)
TPR <164..315 CDD:223533 40/210 (19%)
TPR 1 171..204 9/69 (13%)
TPR 2 219..252 10/47 (21%)
TPR repeat 221..247 CDD:276809 6/40 (15%)
TPR repeat 252..282 CDD:276809 10/29 (34%)
TPR 3 253..286 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.