DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and TWD1

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_188801.2 Gene:TWD1 / 821718 AraportID:AT3G21640 Length:365 Species:Arabidopsis thaliana


Alignment Length:411 Identity:103/411 - (25%)
Similarity:152/411 - (36%) Gaps:137/411 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EGN---KIDLSG---DGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGT-EFDSSLSRNEPFE 60
            |||   |:|...   |..|.|:|:|||.|:: |....|..|||.....:.. :|:.:....:|.|
plant    33 EGNVPPKVDSEAEVLDEKVSKQIIKEGHGSK-PSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIE 96

  Fly    61 FSLGK-GNVIKAFDMGVATMKLGERCFLTCAPNYAYGAAG--SPPAIPPDATLIFELEMLGWKGE 122
            ..||| ...:....:|||:||.|||..:......|||..|  |.|.:||.|.|::|:|::|:   
plant    97 LVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGF--- 158

  Fly   123 DLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAIGIIDGVE 187
                      |.|                        .||:...|..||                
plant   159 ----------DET------------------------KEGKARSDMTVE---------------- 173

  Fly   188 IALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKLSDEERLAEA 252
                 ..:|...|.|:.        ||..||                           ||:|.||
plant   174 -----ERIGAADRRKMD--------GNSLFK---------------------------EEKLEEA 198

  Fly   253 KVYKEKGTNYF----------KKENWALAIKMYTKCKNILPTTVHTNEEVKKIKVATHSNIALCH 307
            ....|....|.          |.::.|||:|  ..|                     |.|||.|.
plant   199 MQQYEMAIAYMGDDFMFQLYGKYQDMALAVK--NPC---------------------HLNIAACL 240

  Fly   308 QKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPGNKAAANQVI 372
            .|...:.||...||.||..::.|.|||:|||:....:.:::.|.:||:|..:..|.:||...::.
plant   241 IKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELR 305

  Fly   373 ICKQKLKESKNKEKKLYANMF 393
            ...::.|....|:|::|..:|
plant   306 ALAEQEKALYQKQKEMYKGIF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 32/95 (34%)
ppisom_GldI <124..233 CDD:132555 14/108 (13%)
BamD 252..>390 CDD:276939 38/147 (26%)
TPR_12 252..329 CDD:290160 21/86 (24%)
TPR repeat 252..280 CDD:276939 9/37 (24%)
TPR repeat 252..280 CDD:276809 9/37 (24%)
TPR repeat 287..326 CDD:276939 12/38 (32%)
TPR repeat 296..326 CDD:276809 12/29 (41%)
TPR_11 299..362 CDD:290150 23/62 (37%)
TPR repeat 329..361 CDD:276939 11/31 (35%)
TPR_1 331..364 CDD:278916 11/32 (34%)
TPR repeat 331..359 CDD:276809 10/27 (37%)
TWD1NP_188801.2 FKBP_C 62..156 CDD:395196 31/94 (33%)
PRK15331 196..310 CDD:357168 36/136 (26%)
TPR repeat 230..259 CDD:276809 13/49 (27%)
TPR repeat 264..292 CDD:276809 10/27 (37%)
TPR repeat 298..323 CDD:276809 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3893
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.