DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and AT2G43560

DIOPT Version :10

Sequence 1:NP_524895.2 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_181884.1 Gene:AT2G43560 / 818958 AraportID:AT2G43560 Length:223 Species:Arabidopsis thaliana


Alignment Length:109 Identity:33/109 - (30%)
Similarity:57/109 - (52%) Gaps:5/109 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGV 76
            :.|:..:.:|.|.| .:|..|..|:.:|...:..|..|||||.:..|:.|.:|.|.|||..|.|:
plant   105 ESGLQYKDIKVGRG-PSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGI 168

  Fly    77 ATMKLG--ERCFLTCAPNYAYGAAGSP--PAIPPDATLIFELEM 116
            .:||.|  .|.::.....:..|...:|  |.:.|::.:||::.:
plant   169 LSMKAGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_524895.2 FKBP_C 25..117 CDD:459735 30/96 (31%)
SlpA 147..>210 CDD:440668
NlpI <245..402 CDD:443815
TPR repeat 252..280 CDD:276809
TPR repeat 296..326 CDD:276809
TPR repeat 331..359 CDD:276809
AT2G43560NP_181884.1 FkpA 108..212 CDD:440311 32/104 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.