DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and Fkbp11

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_077131.2 Gene:Fkbp11 / 66120 MGIID:1913370 Length:201 Species:Mus musculus


Alignment Length:92 Identity:35/92 - (38%)
Similarity:54/92 - (58%) Gaps:1/92 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFEFSLGKGNVIKAFDMGVATMKLGERCFLTCA 90
            ||:...|.|:.:||||.||||...|:||:| :|....||:..||...:..:..|.:||:......
Mouse    51 TESAAIGDTLHIHYTGSLVDGRIIDTSLTR-DPLVIELGQKQVIPGLEQSLLDMCVGEKRRAVIP 114

  Fly    91 PNYAYGAAGSPPAIPPDATLIFELEML 117
            .:.|||..|.||:||.||.:.:::|::
Mouse   115 SHLAYGKRGYPPSIPADAVVQYDVELI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 35/90 (39%)
ppisom_GldI <124..233 CDD:132555
BamD 252..>390 CDD:276939
TPR_12 252..329 CDD:290160
TPR repeat 252..280 CDD:276939
TPR repeat 252..280 CDD:276809
TPR repeat 287..326 CDD:276939
TPR repeat 296..326 CDD:276809
TPR_11 299..362 CDD:290150
TPR repeat 329..361 CDD:276939
TPR_1 331..364 CDD:278916
TPR repeat 331..359 CDD:276809
Fkbp11NP_077131.2 FKBP_C 50..141 CDD:278674 35/90 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.