DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp59 and Aipl1

DIOPT Version :9

Sequence 1:NP_001285784.1 Gene:Fkbp59 / 47762 FlyBaseID:FBgn0029174 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_067601.1 Gene:Aipl1 / 59110 RGDID:70906 Length:328 Species:Rattus norvegicus


Alignment Length:397 Identity:80/397 - (20%)
Similarity:150/397 - (37%) Gaps:99/397 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVLKEILKEGTGTETPH--SGCTVSLHYTGRLVD--GTEFDSSLSRNEPFEFSLGKGNVIKAFDM 74
            ||.|.||..||| |.|:  :|..|:.|:.....|  .|..|.|....:|....:|....::.::.
  Rat    11 GVKKTILHGGTG-ELPNFITGSRVTFHFRTMKCDEERTVIDDSKQVGQPMNIIIGNMFKLEVWET 74

  Fly    75 GVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEMLGWKGEDLSPNQDGSIDRTILEA 139
            .:.:|:|||.....|...:               |.::.:                 :.|::.:.
  Rat    75 LLTSMRLGEVAEFWCDTIH---------------TGVYPM-----------------LSRSLRQV 107

  Fly   140 SDKKRTPSDGAFVKAHISG-----SFEGRVFEDRDVEFDYGEGKAIGIIDGVEIALEKMNVGETS 199
            ::.|    |......|..|     ::....:||.| |........|.:|:               
  Rat   108 AEGK----DPTSWHVHTCGLANMFAYHTLGYEDLD-ELQKEPQPLIFLIE--------------- 152

  Fly   200 RIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWKLSDEERLAEAKVYKEKGTNYFK 264
            .::::|               ||   ||.         .|.|.|::|||:....:...:|...:|
  Rat   153 LLQVEA---------------PN---EYQ---------RETWNLNNEERMQAVPLLHGEGNRLYK 190

  Fly   265 KENWALAIKMYTKCKNILPTTVHTNE---EVKKIKVATHSNIAL-----CHQKSNDHFEAKQECN 321
            ...:..|...|.:....| ..:.|.|   ||:.:|:....|..:     |..|..:::|..:..:
  Rat   191 LGRYDQAATKYQEAIVCL-RNLQTKEKPWEVEWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTS 254

  Fly   322 EVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQLEPG-NKAAANQVIICKQKLKESKNKE 385
            ::|......|||.|.|.:.:..:...|:|..|.:||::|||. .||...::.:.:.:|.:.:.:|
  Rat   255 DILRHHPGIVKAYYMRARAHAEVWNAEEAKADLEKVLELEPSMRKAVLRELRLLESRLADKQEEE 319

  Fly   386 KKLYANM 392
            ::...:|
  Rat   320 RQRCRSM 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp59NP_001285784.1 FKBP_C 25..117 CDD:278674 18/95 (19%)
ppisom_GldI <124..233 CDD:132555 16/113 (14%)
BamD 252..>390 CDD:276939 32/146 (22%)
TPR_12 252..329 CDD:290160 15/84 (18%)
TPR repeat 252..280 CDD:276939 4/27 (15%)
TPR repeat 252..280 CDD:276809 4/27 (15%)
TPR repeat 287..326 CDD:276939 10/46 (22%)
TPR repeat 296..326 CDD:276809 6/34 (18%)
TPR_11 299..362 CDD:290150 16/67 (24%)
TPR repeat 329..361 CDD:276939 10/31 (32%)
TPR_1 331..364 CDD:278916 13/33 (39%)
TPR repeat 331..359 CDD:276809 10/27 (37%)
Aipl1NP_067601.1 FKBP_C 30..>89 CDD:302890 13/58 (22%)
TPR 1 178..211 5/33 (15%)
TPR_11 180..261 CDD:290150 15/81 (19%)
TPR repeat 180..224 CDD:276809 9/44 (20%)
TPR repeat 229..259 CDD:276809 5/29 (17%)
TPR 2 230..263 5/32 (16%)
TPR 3 264..297 13/32 (41%)
TPR repeat 264..292 CDD:276809 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897391at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.